PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G123200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 286aa    MW: 31845 Da    PI: 7.4571
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G123200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.81e-0710352148
                          TT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding 21 ggtWktIartmgkgRtlkqcksrwqkyl 48
                          +  W+ Iar ++ gR++ qc++rw  yl
  Sobic.004G123200.2.p 10 N-KWSDIARSIP-GRSRRQCQERWMYYL 35
                          4.5*********.***********9986 PP

2Myb_DNA-binding49.78.5e-164286248
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          ++W+++Ed  l++a++ +G++ W + a++++ gRt+k +k++w++++
  Sobic.004G123200.2.p 42 QPWSEQEDITLIRAHRIFGNK-WCKLAKHFP-GRTGKAIKNHWHTLM 86
                          79*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.387135IPR017877Myb-like domain
SMARTSM0071728237IPR001005SANT/Myb domain
CDDcd001675.06E-6935No hitNo description
PfamPF002498.7E-6935IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-121039IPR009057Homeodomain-like
SuperFamilySSF466897.49E-261590IPR009057Homeodomain-like
PROSITE profilePS5129421.5973690IPR017930Myb domain
SMARTSM007171.8E-144088IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-214088IPR009057Homeodomain-like
PfamPF002492.7E-144285IPR001005SANT/Myb domain
CDDcd001672.71E-134386No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MVTRCPHCKN KWSDIARSIP GRSRRQCQER WMYYLDPAVN NQPWSEQEDI TLIRAHRIFG  60
NKWCKLAKHF PGRTGKAIKN HWHTLMNGKR NSDYVRGLTI DNKCSGSIKS GQDSCINIQV  120
AVDCPIRPKP EQGFTEDGRN AALKKKGSDS MSSEWYVSVN VSEGQIARSS LPVVTKEKEV  180
LPSSSVDQKV SCVAAKFSTS LPKKELANCL EAPLNGLDAG LYPAHDHVSI HDHFDDICSS  240
ANPESPELHQ LANIAELLDM SYCDSLMIVP PDSPNDGNSM EGMWY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-21118949127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794350.0HF679435.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB29 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453679.10.0hypothetical protein SORBIDRAFT_04g010280
TrEMBLC5XZZ90.0C5XZZ9_SORBI; Putative uncharacterized protein Sb04g010280
STRINGSb04g010280.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.18e-28myb domain protein 3r-4